42podarka.ru valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title Интересные идеи оригинальных подарков или что подарить парню, что подарить девушке | 42 подарка
Description Не знаете, что подарить близкому человеку на праздник? Кажется, что у него уже все есть? Здесь вы найдете свежие идеи оригинальных подарков по любому поводу. Присоединяйтесь!
Keywords подарки, что подарить, оригинальные подарки, истории подарков, что подарить парню, что подарить девушке, необычные подарки, интересные подарки, оригинальные подарки, подарок на 8 марта, подарок на 23 февраля, подарок на Новый год, подарок на день рождения
Server Information
WebSite 42podarka favicon www.42podarka.ru
Host IP 92.53.96.132
Location Russia
Related Websites
Site Rank
algebrazhizni.ru #640,848
smilegifts.ru #1,020,100
topideipodarkov.ru #137,562
funfrom.me #151,369
podarok-super.ru #928,626
More to Explore
51logon.com
51xyyx.com
aba-sys.com
abbasi1357.blogfa.com
abhisheksuneri.com
acheterpaschernikeflyknitairmaxvivid.info
acilankara.com
aclufl.org
actiontakingblogger.com
activarantivirus.com
brero.ch
butterflyatlas.org
42podarka.ru Valuation
US$6,112
Last updated: Jan 6, 2020

42podarka.ru has global traffic rank of 3,058,457 and ranks the 158,633rd in Russia. 42podarka.ru has an estimated worth of US$ 6,112, based on its estimated Ads revenue. 42podarka.ru receives approximately 1,014 unique visitors each day. Its web server is located in Russia, with IP address 92.53.96.132. According to SiteAdvisor, 42podarka.ru is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$6,112
Daily Ads Revenue US$3
Monthly Ads Revenue US$100
Yearly Ads Revenue US$1,222
Daily Unique Visitors 1,014
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 3,058,457
Delta (90 Days) 0
Most Popular In Country Russia
Country Rank 158,633
DNS Records
Host Type TTL Data
42podarka.ru A 599 IP: 92.53.96.132
42podarka.ru AAAA 599 IPv6: 2a03:6f00:1:0:0:0:5c35:6084
42podarka.ru MX 599 Priority: 10
Target: mx1.timeweb.ru.
42podarka.ru MX 599 Priority: 20
Target: mx2.timeweb.ru.
42podarka.ru NS 599 Target: ns3.timeweb.org.
42podarka.ru NS 599 Target: ns4.timeweb.org.
42podarka.ru NS 599 Target: ns1.timeweb.ru.
42podarka.ru NS 599 Target: ns2.timeweb.ru.
42podarka.ru TXT 599 TXT: v=spf1 ip4:176.57.223.0/24 ip4:92.53.116.0/22 ip4:92.53.96.0/22 ip4:92.53.112.0/22 ip4:92.53.104.0/22 ip6:2a03:6f00::/32 ~all
42podarka.ru SOA 599 MNAME: ns1.timeweb.ru.
RNAME: dns.timeweb.ru.
Serial: 22092024
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
HTTP Headers
HTTP/1.1 301 Moved Permanently
Server: nginx/1.14.1
Date: Mon, 06 Jan 2020 09:23:39 GMT
Content-Type: text/html; charset=iso-8859-1
Content-Length: 233
Connection: keep-alive
Location: https://www.42podarka.ru/

HTTP/2 200 
server: nginx/1.14.1
date: Mon, 06 Jan 2020 09:23:39 GMT
content-type: text/html; charset=UTF-8
vary: Accept-Encoding
p3p: policyref="/bitrix/p3p.xml", CP="NON DSP COR CUR ADM DEV PSA PSD OUR UNR BUS UNI COM NAV INT DEM STA"
x-powered-cms: Bitrix Site Manager (c6d3d99ae37fcf6b5a700f1194068460)
set-cookie: PHPSESSID=5c7bcd83c1b376b1a306ae55eb8f776e; path=/; domain=www.42podarka.ru; HttpOnly
expires: Thu, 19 Nov 1981 08:52:00 GMT
cache-control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
pragma: no-cache

42podarka.ru Whois Information
domain:        42PODARKA.RU
nserver:       ns1.timeweb.ru.
nserver:       ns2.timeweb.ru.
nserver:       ns3.timeweb.org.
nserver:       ns4.timeweb.org.
state:         REGISTERED, DELEGATED, VERIFIED
person:        Private Person
registrar:     R01-RU
admin-contact: https://partner.r01.ru/contact_admin.khtml
created:       2012-09-22T15:03:36Z
paid-till:     2020-09-22T16:03:36Z
free-date:     2020-10-23
source:        TCI

Last updated on 2020-01-06T09:21:33Z